PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G456700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 449aa    MW: 48586.5 Da    PI: 6.57
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G456700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS401.86.8e-123504431374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPi 90 
                         l++lLl+cA a ++g l +a+a+L+++  la+pdgd+mqR+aa f+eALa+r +r +++l++al  p++++    +e +aa++ f +++P+
  Sevir.5G456700.1.p  50 LIHLLLNCAAAAAAGRLDAANAALEHIASLAAPDGDAMQRVAAAFAEALARRALRAWPGLCRALlLPRAAP--AAAELAAARRHFLDLCPF 138
                         689************************************************************95455544..68999999999******* PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                         l+++  +aNq Ilea+e+e+ vH+iD++    +QW+ Ll+ La+Rpegpp+lR+T+v++    +k+ l +t+  L+k Ae+l+vpf+fn+ 
  Sevir.5G456700.1.p 139 LRIAGAAANQCILEAMESEKIVHVIDLGGADATQWLELLHLLAARPEGPPHLRLTAVHE----HKDVLAQTAMALTKEAERLDVPFQFNP- 224
                         ***********************************************************....9**************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrll..........................desvsleserdevLklvkslsPkvvvvveqea 246
                         v+ rl++l++e+Lrvk+gEala+ ++lqlh ll                          +   +++s+ d++L ++++lsPk++v++eqea
  Sevir.5G456700.1.p 225 VVCRLDALDVESLRVKTGEALAITSSLQLHCLLasdddsaagagkdnnnsnkterrspeSGLSPSTSRADAFLGALWGLSPKLMVLTEQEA 315
                         6899***************************************************997522233444789********************* PP

                GRAS 247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                         +hn++ + erf+eal+yy+alfd+le+ ++r s er+ vEr llg+ei+n+vac g errerhe+l +W +r+e aGF+ vp+s++a  qa
  Sevir.5G456700.1.p 316 SHNAAALTERFVEALNYYAALFDCLEVVAARGSVERARVERWLLGEEIKNIVACDGVERRERHERLDRWAARMEGAGFGRVPMSYYALLQA 406
                         ******************************************************************************************* PP

                GRAS 338 klllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++  +  + dg++v ee+gs++l+W+dr+++svSaWr
  Sevir.5G456700.1.p 407 RRAAQGLGCDGFKVREEKGSFFLCWQDRAIFSVSAWR 443
                         ************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.25924423IPR005202Transcription factor GRAS
PfamPF035142.3E-12050443IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MVQDEGSSSS VTSSPLHNFS AMPLHPAAAA APTPPWLLRE LRSDERGLCL IHLLLNCAAA  60
AAAGRLDAAN AALEHIASLA APDGDAMQRV AAAFAEALAR RALRAWPGLC RALLLPRAAP  120
AAAELAAARR HFLDLCPFLR IAGAAANQCI LEAMESEKIV HVIDLGGADA TQWLELLHLL  180
AARPEGPPHL RLTAVHEHKD VLAQTAMALT KEAERLDVPF QFNPVVCRLD ALDVESLRVK  240
TGEALAITSS LQLHCLLASD DDSAAGAGKD NNNSNKTERR SPESGLSPST SRADAFLGAL  300
WGLSPKLMVL TEQEASHNAA ALTERFVEAL NYYAALFDCL EVVAARGSVE RARVERWLLG  360
EEIKNIVACD GVERRERHER LDRWAARMEG AGFGRVPMSY YALLQARRAA QGLGCDGFKV  420
REEKGSFFLC WQDRAIFSVS AWRGRRFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-48504434375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0975350.0FP097535.1 Phyllostachys edulis cDNA clone: bphylf044j19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971220.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-171SCL3_ARATH; Scarecrow-like protein 3
TrEMBLC5XHT90.0C5XHT9_SORBI; Putative uncharacterized protein Sb03g045660
STRINGSb03g045660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-116scarecrow-like 3